Protein Info for Psest_0399 in Pseudomonas stutzeri RCH2

Annotation: Acyl-CoA dehydrogenases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 transmembrane" amino acids 298 to 318 (21 residues), see Phobius details PF12418: AcylCoA_DH_N" amino acids 9 to 34 (26 residues), 24.3 bits, see alignment (E = 6.6e-09) PF02771: Acyl-CoA_dh_N" amino acids 43 to 156 (114 residues), 35.7 bits, see alignment E=2.6e-12 PF02770: Acyl-CoA_dh_M" amino acids 162 to 269 (108 residues), 38.7 bits, see alignment E=2.4e-13 PF00441: Acyl-CoA_dh_1" amino acids 285 to 455 (171 residues), 57.7 bits, see alignment E=3.9e-19 PF12806: Acyl-CoA_dh_C" amino acids 473 to 600 (128 residues), 113 bits, see alignment E=2.5e-36

Best Hits

KEGG orthology group: K00248, butyryl-CoA dehydrogenase [EC: 1.3.8.1] (inferred from 95% identity to psa:PST_3878)

Predicted SEED Role

"3-methylmercaptopropionyl-CoA dehydrogenase (DmdC)"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.8.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GI00 at UniProt or InterPro

Protein Sequence (604 amino acids)

>Psest_0399 Acyl-CoA dehydrogenases (Pseudomonas stutzeri RCH2)
MTETLLCPRNLAFELYEVLDAEALTRREHFADHSRETFDAAIGTARTIAEKYFAPHNRKS
DEHEPQYVNGEAVLIPEVKPAVDAFIEAGFHNAQRSFDDGGMQLPNLLSRACFAHFQSAN
IATSSYPMLSMGASHLIETFGSEEQKQRFLQPMLEGRFFGTMALTEPHAGSSLSDIRTRA
EPAGDGSYRLKGNKIFISGGDHPLSENIVHMVLAKLPDAPPGVKGISLFIVPKFLVNDDG
SLGQRNDVLLAGLFHKMGWRGTTSTALNFGDNGNCVGYLVGEPHKGLAYMFQMMNEARIG
VGMGAIMLGYAGYLYSLNYARERPQGRPQGRLPDGKDPASSQVPIIEHTDVKRMLLMQKA
YVEGAFDLGLYSARLVDDEHTAESEEERRNASELLDLLTPIVKSWPSEYCLKANELAIQI
LGGHGYTREYPVEQYYRDNRLNPIHEGTHGIQSLDLLGRKLMQNKGAGLRQLLGLIQASC
ARAAEYDSLTALRKPLEQHIARLTSVTQALLGDLAAGKVNQALANSALYLKVFGHAVIGW
RWLEQALRAERGLAEGNAADADFYRGKLQAARYFLTWEVPACEPELAILEARDDTCLTMQ
DAWF