Protein Info for HP15_3919 in Marinobacter adhaerens HP15

Annotation: tripartite ATP-independent periplasmic transporter, DctQ component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 126 to 147 (22 residues), see Phobius details PF04290: DctQ" amino acids 22 to 153 (132 residues), 103 bits, see alignment E=5.8e-34

Best Hits

KEGG orthology group: None (inferred from 46% identity to rpx:Rpdx1_1873)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJX3 at UniProt or InterPro

Protein Sequence (174 amino acids)

>HP15_3919 tripartite ATP-independent periplasmic transporter, DctQ component (Marinobacter adhaerens HP15)
MRGVTRLNDFIGRWVALLIFAMFAFLLLEVGFRYLFNSPTVWTNELTQMLFGIYAVMSGG
YIMAHRGHVNVDLLHSHLRPRKRAVLDIVTSLVFFIFTLALLWFGIDMAQESMSSWETSY
SAWNPPIWPVKLAIPIGTALLVLQGLVKLLEDIAVAFNLDYYTPEESESEGEQL