Protein Info for PGA1_65p00450 in Phaeobacter inhibens DSM 17395

Annotation: UDP-glucose 6-dehydrogenase Ugd

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR03026: nucleotide sugar dehydrogenase" amino acids 1 to 414 (414 residues), 459 bits, see alignment E=6.5e-142 PF03721: UDPG_MGDP_dh_N" amino acids 1 to 184 (184 residues), 229.2 bits, see alignment E=4.5e-72 PF00984: UDPG_MGDP_dh" amino acids 201 to 293 (93 residues), 127.6 bits, see alignment E=2.4e-41 PF03720: UDPG_MGDP_dh_C" amino acids 317 to 417 (101 residues), 103.1 bits, see alignment E=1.5e-33

Best Hits

Swiss-Prot: 62% identical to UDG_RHIME: UDP-glucose 6-dehydrogenase (rkpK) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00012, UDPglucose 6-dehydrogenase [EC: 1.1.1.22] (inferred from 94% identity to sit:TM1040_3775)

MetaCyc: 48% identical to UDP-glucose 6-dehydrogenase (Bacillus subtilis subtilis 168)
UDP-glucose 6-dehydrogenase. [EC: 1.1.1.22]

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.22

Use Curated BLAST to search for 1.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F2X6 at UniProt or InterPro

Protein Sequence (434 amino acids)

>PGA1_65p00450 UDP-glucose 6-dehydrogenase Ugd (Phaeobacter inhibens DSM 17395)
MRIAMIGTGYVGLVSGVCFSDFGHDVVCVDKDAAKIARLQAGEVPIYEPGLEDLMARNVA
AGRLSFTDDLAAAVAEAEAVFIAVGTPTRRGDGHADLTYVMAASEEIAAALQGYTVVVTK
STVPLGTNRQVKQVIAKSNPAADFDVASNPEFLREGAAIDDFMRPDRVVVGVQNDRAAEV
MAEIYRPLYLRDFPILTTDLESAEMIKYAANAFLATKITFMNEIAGLCERVGSDVKEVAR
GIGLDGRIGNKFLHAGPGYGGSCFPKDTAALARIGQDHAYPMQITETVMRVNQEVKARML
EKLRDACDGSFNGKTIAVLGVTFKPNTDDMREAPSLTIVPALIGGGARVRVVDPQGEAEG
RDLLPGVRWEEDPYKAARNADLVVLLTEWNEFRALDLKALARKMAQPRMVDLRNIYTAKA
AKRAGFETYVGVGR