Protein Info for PGA1_65p00390 in Phaeobacter inhibens DSM 17395

Annotation: UDP-galactopyranose mutase Glf

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00031: UDP-galactopyranose mutase
  • amino acids 2 to 368 (367 residues), 312.5 bits, E=1.9e-97
• PF13450: NAD_binding_8
  • amino acids 6 to 71 (66 residues), 65.3 bits, E=7.4e-22
• PF01593: Amino_oxidase
  • amino acids 10 to 220 (211 residues), 45.7 bits, E=8.7e-16
• PF03275: GLF
  • amino acids 153 to 352 (200 residues), 267.7 bits, E=1e-83

Best Hits

Swiss-Prot: 53% identical to FCF2_ECOLX: dTDP-fucopyranose mutase (fcf2) from Escherichia coli

KEGG orthology group: K01854, UDP-galactopyranose mutase [EC: 5.4.99.9] (inferred from 78% identity to hel:HELO_3596)

MetaCyc: 53% identical to dTDP-fucopyranose mutase (Escherichia coli O52)
RXN-14533 [EC: 5.4.99.59]

Predicted SEED Role

"UDP-galactopyranose mutase (EC 5.4.99.9)" in subsystem LOS core oligosaccharide biosynthesis or linker unit-arabinogalactan synthesis (EC 5.4.99.9)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (2/2 steps found)
• dTDP-β-D-fucofuranose biosynthesis (3/4 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (7/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (14/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (2/18 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.99.59 or 5.4.99.9

Sequence Analysis Tools

See I7DX72 at UniProt or InterPro

Protein Sequence (387 amino acids)

>PGA1_65p00390 UDP-galactopyranose mutase Glf (Phaeobacter inhibens DSM 17395)
MNILMVGAGLSGAVIGRHLAEAGHKITVLDSRDHIGGNCHTARDAETGVMVHVYGPHIFH
TDDAEVWEYVNGFESFLPYKNRVKTTSLDPEGRRGVFSLPVNLHTINQFFGKTLRPEEAH
DFITEEQADTSITDPQTFEEQALRFVGRDLYEAFFKGYTIKQWGVAPSALPASILKRLPV
RFNYDDNYFFHKYQGMPENGYTAMIEKILDHPGITVKLETVFDQSQAADYDHVFYSGPLD
GYFNYQLGRLGYRTLDFERFTHQGDYQGCAVMNYGEEAVPYTRITEHKHFAPWESHDGSV
CYREFSRAAEPEDIPYYPIRQVEEKALLGEYVALAEQAEGVTFVGRLGTYRYLDMDVTIR
EALDTARGFLAAQENRAPVPAFFVAPL