Protein Info for PGA1_65p00350 in Phaeobacter inhibens DSM 17395

Annotation: hemolysin-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 533 PF00353: HemolysinCabind" amino acids 246 to 280 (35 residues), 27.8 bits, see alignment 1e-10 amino acids 255 to 289 (35 residues), 34 bits, see alignment 1.1e-12 amino acids 282 to 314 (33 residues), 14.2 bits, see alignment (E = 1.8e-06) amino acids 311 to 344 (34 residues), 21.3 bits, see alignment (E = 1.1e-08) amino acids 361 to 382 (22 residues), 18.7 bits, see alignment (E = 7.2e-08) amino acids 401 to 434 (34 residues), 38.2 bits, see alignment (E = 5.6e-14) amino acids 427 to 460 (34 residues), 29.2 bits, see alignment (E = 3.6e-11)

Best Hits

Predicted SEED Role

"Alkaline phosphatase (EC 3.1.3.1)" in subsystem Phosphate metabolism (EC 3.1.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.1

Use Curated BLAST to search for 3.1.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F2W5 at UniProt or InterPro

Protein Sequence (533 amino acids)

>PGA1_65p00350 hemolysin-like protein (Phaeobacter inhibens DSM 17395)
MANINVATGVNFEFGTTGDDAITLVDTLVDTAGETLNGNGGTDSITLNNAGDSLLKFLDT
NGVLTYDTTIPGSEHWDLDDDSTSAVSTVELNGGINSVTFATGETLTVGTASAGTTALTS
AIGGGGNGTADISTARAYEWSGTAVTTNTALNIGANPTDYSLVSVDGIAVGAANFSNADG
QFNVNANVVTFTPNTAAIAAQGNVGDTASFTYDVVVEHNTTGEQSTVSVTYSQEIDYTAG
NDTFTGTDAVDTENGLAGDDMISGGEGNDSLTGGSGNDTLLGENGNDDLVGDAGVNVLRG
GNGNDELTTSGTDDGNTLGGGAGSDVIVGNDGDDIIFGGNGDDNVAGSGDATGAAATQNG
LIGGKGDDIINGGGGDDILRGDLAGATLTSAGTTTAGDASDDGNDTLRGGDGNDTLYGDD
GNDELRGGAGDDVVNGGAGADMMYVSLGDDIMDGGAGDDTFILRDDSGETTINGFAVGDK
LNVEALGYSDLAAVLATSYETDAGVVIAIDADTTVLLDGLSLTDLDTSDFDFA