Protein Info for Psest_4001 in Pseudomonas stutzeri RCH2

Annotation: acetylornithine deacetylase (ArgE)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 TIGR01892: acetylornithine deacetylase (ArgE)" amino acids 10 to 374 (365 residues), 395.1 bits, see alignment E=1.5e-122 PF01546: Peptidase_M20" amino acids 73 to 375 (303 residues), 111.4 bits, see alignment E=5.6e-36 PF07687: M20_dimer" amino acids 175 to 284 (110 residues), 78 bits, see alignment E=4.9e-26

Best Hits

Swiss-Prot: 51% identical to ARGE_EDWI9: Acetylornithine deacetylase (argE) from Edwardsiella ictaluri (strain 93-146)

KEGG orthology group: K01438, acetylornithine deacetylase [EC: 3.5.1.16] (inferred from 96% identity to psa:PST_0274)

MetaCyc: 50% identical to acetylornithine deacetylase (Escherichia coli K-12 substr. MG1655)
Acetylornithine deacetylase. [EC: 3.5.1.16]

Predicted SEED Role

"Acetylornithine deacetylase (EC 3.5.1.16)" in subsystem Arginine Biosynthesis extended (EC 3.5.1.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSZ5 at UniProt or InterPro

Protein Sequence (386 amino acids)

>Psest_4001 acetylornithine deacetylase (ArgE) (Pseudomonas stutzeri RCH2)
MPIPSFKEQFAQLLAAPSVSCTQPGWDQSNRPVIELLAAWLGELGFACETPEVAPGKFNL
LASYGSGPGGLVLAGHSDTVPFDAGLWTSDPLKLREADGRWYGLGSCDMKGFFALIIEAV
RPLLEQPFRRPLLILATCDEESSMSGARALAEAGQPLGRAAVIGEPTGLRPVRLHKGIMM
ERIDILGQSGHSSNPAYGHSALEAMHGVMGEMMTLRRQWQGEYDNPLFDVPKPTLNFGCI
HGGDNPNRICGQCSLEFDLRPLPGMDPQQLRTIIRQRLQPLAEQHQVKIDLAPLFPAVPP
FEQAAESELVRLAERLTGHRAEAVAFATEAPYLQQLGCETLVLGPGDIACAHQPDEYLQL
DRIEPTLQLLRRMIEHYCLQPQTAPN