Protein Info for PGA1_c04040 in Phaeobacter inhibens DSM 17395

Annotation: phenylacetic acid degradation NADH oxidoreductase PaaE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 TIGR02160: phenylacetate-CoA oxygenase/reductase, PaaK subunit" amino acids 4 to 356 (353 residues), 421.8 bits, see alignment E=8.8e-131 PF00970: FAD_binding_6" amino acids 27 to 103 (77 residues), 37.7 bits, see alignment E=3.3e-13 PF00175: NAD_binding_1" amino acids 119 to 223 (105 residues), 62.8 bits, see alignment E=6.9e-21 PF00111: Fer2" amino acids 272 to 346 (75 residues), 71.6 bits, see alignment E=6.3e-24

Best Hits

KEGG orthology group: K02613, phenylacetic acid degradation NADH oxidoreductase (inferred from 82% identity to sil:SPO0753)

MetaCyc: 49% identical to ring 1,2-phenylacetyl-CoA epoxidase PaaE subunit (Pseudomonas sp. Y2)
RXN0-2042 [EC: 1.14.13.149]

Predicted SEED Role

"Phenylacetate-CoA oxygenase/reductase, PaaK subunit"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.149

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJ14 at UniProt or InterPro

Protein Sequence (357 amino acids)

>PGA1_c04040 phenylacetic acid degradation NADH oxidoreductase PaaE (Phaeobacter inhibens DSM 17395)
MARFHDLVVTDVRKTIRDAVVVTLKPVGGAAEEFDFTQGQYLTFRRDFDGEELRRSYSIC
AGKDEGILQVGIKRVDGGAFSTWANTELKAGDTLQAMAPMGSFFTPLNEAAEKHYLGFAG
GSGITPVLSILKTTLAAEPNASFTLVYANKGVNTIMFREELEDLKNLYMGRFNLIHVLES
DAQEIDLFTGLVTEEKCAQLFERWIDIKSVDTAFICGPEPMMLGIASALRTAGLNDSQIK
FELFASAQPGRAKRKVTAGGTGTGANQTKAAITLDGATQTIEIGKDMTLLDAALENAMDA
PYACKAGVCSTCRCKVLEGEVEMIANHALEDYEVEKGYVLSCQAYPLSDKVVVDYDQ