Protein Info for PGA1_65p00260 in Phaeobacter inhibens DSM 17395

Annotation: putative metallopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 483 PF08548: Peptidase_M10_C" amino acids 220 to 438 (219 residues), 58.7 bits, see alignment E=7.2e-20 PF00353: HemolysinCabind" amino acids 323 to 357 (35 residues), 22.1 bits, see alignment 1.2e-08 amino acids 351 to 385 (35 residues), 30.5 bits, see alignment 2.8e-11 amino acids 378 to 411 (34 residues), 36.2 bits, see alignment (E = 4.8e-13) amino acids 387 to 420 (34 residues), 27 bits, see alignment (E = 3.6e-10)

Best Hits

Predicted SEED Role

"beta-lactamase, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETB5 at UniProt or InterPro

Protein Sequence (483 amino acids)

>PGA1_65p00260 putative metallopeptidase (Phaeobacter inhibens DSM 17395)
MPTYQDYRALLVDGADGWHEGSEVIRYHFLTSVPDYYDYDPDFGDYDVGGEYLPEGATVN
MDPAERQMMLQAVAAWNEVANLNLIPARGGTADLTFASAHFANAGLFGFIVDFPDPSDLG
TRPSPAGDLWLNNSNPDQYVPGIGPILGHTSWNTYLHELGHALGLHHPNEMPENPTTPGQ
FTVMSYLPHPGDADLGQDLQGWALTPMLWDMQAVQALYGANTETRTDATVYLGAGDGRGG
QAYQYGADGMTVRGGDGVARNVSLTIWDAGGQDLIDASDIETNSRIDLRPGQYSSIGTLE
NNVAMAAAVRLDGRTLNLIEDAWGGAGHDHLIGNGAANELLGNAGRDTLAGARGGDELSG
GQGSDRLQGGKGHDALEGGRGRDTLKGGAGQDRLDGGDGNDRMAGGRGADVFVFSQGADV
VIDFQRDDRIDMRATTGVSDFADLRDDHLEVRGADLVIRDDNGWSLTLQDTAFDVLRTDD
FLF