Protein Info for Psest_3992 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein conserved in archaea

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF05618: Zn_protease" amino acids 9 to 146 (138 residues), 153.6 bits, see alignment E=1.5e-49

Best Hits

KEGG orthology group: None (inferred from 98% identity to psa:PST_0289)

Predicted SEED Role

"hypothetical protein sometimes fused to ribosomal protein S6 glutaminyl transferase" in subsystem Ribosome biogenesis bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GR57 at UniProt or InterPro

Protein Sequence (155 amino acids)

>Psest_3992 Uncharacterized protein conserved in archaea (Pseudomonas stutzeri RCH2)
MKRLDPHTVIGLREWIALPDLGVVGLRAKVDTGASTSALHATEISEFERDGQRWVRFTAH
LGTLVQRRHRCEAPLVTRKLIKSSNGQVQTRYVVRTLLALGSHVWPVEFTLTCRKTMRYR
LLLGSKALIDGQWLIDPSRTYIQDKPQILTSSGAQ