Protein Info for HP15_3862 in Marinobacter adhaerens HP15

Annotation: pyridoxamine 5'-phosphate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00558: pyridoxamine 5'-phosphate oxidase
  • amino acids 24 to 236 (213 residues), 293.3 bits, E=5.3e-92
• PF01243: Putative_PNPOx
  • amino acids 59 to 143 (85 residues), 89.9 bits, E=9.9e-30
• PF10590: PNP_phzG_C
  • amino acids 196 to 236 (41 residues), 76.1 bits, 1.6e-25

Best Hits

Swiss-Prot: 89% identical to PDXH_MARHV: Pyridoxine/pyridoxamine 5'-phosphate oxidase (pdxH) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K00275, pyridoxamine 5'-phosphate oxidase [EC: 1.4.3.5] (inferred from 89% identity to maq:Maqu_0155)

MetaCyc: 53% identical to pyridoxine/pyridoxamine 5'-phosphate oxidase (Escherichia coli K-12 substr. MG1655)
Pyridoxal 5'-phosphate synthase. [EC: 1.4.3.5]; 1.4.3.5 [EC: 1.4.3.5]

Predicted SEED Role

"Pyridoxamine 5'-phosphate oxidase (EC 1.4.3.5)" in subsystem Pyridoxin (Vitamin B6) Biosynthesis (EC 1.4.3.5)

MetaCyc Pathways

• pyridoxal 5'-phosphate biosynthesis I (7/7 steps found)
• superpathway of pyridoxal 5'-phosphate biosynthesis and salvage (8/12 steps found)
• pyridoxal 5'-phosphate salvage I (2/6 steps found)
• 4-amino-2-methyl-5-diphosphomethylpyrimidine biosynthesis II (2/8 steps found)
• pyridoxal 5'-phosphate salvage II (plants) (2/9 steps found)

KEGG Metabolic Maps

• Vitamin B6 metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.5

Use Curated BLAST to search for 1.4.3.5

Sequence Analysis Tools

See E4PJ28 at UniProt or InterPro

Protein Sequence (236 amino acids)

>HP15_3862 pyridoxamine 5'-phosphate oxidase (Marinobacter adhaerens HP15)
MNPEPDMLLARISPGSFYAQARGQVMDIGDMRRDFESEGLDRDALDNNPVQQFQNWFEDA
REAGILEPNAMSLATTGQDGMPDLRTVLLKYFDDHGFVFYTNYGSRKAKEMEENPQAALL
FPWIGLNRQVRIQGAVEKVSKAESLRYFASRPRGSQIGAWVSEQSKAITSRGLLEQKVAE
IKRKFSEGEVPLPSFWGGYRIVPERIEFWQGRPSRLHDRFEYVRKGDGWLIQRLQP