Protein Info for PGA1_c04030 in Phaeobacter inhibens DSM 17395

Annotation: phenylacetic acid degradation protein paaA-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details PF05138: PaaA_PaaC" amino acids 20 to 253 (234 residues), 86.2 bits, see alignment E=1.1e-28

Best Hits

KEGG orthology group: None (inferred from 65% identity to sil:SPO0752)

Predicted SEED Role

"Phenylacetic acid catabolic protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETU3 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PGA1_c04030 phenylacetic acid degradation protein paaA-like protein (Phaeobacter inhibens DSM 17395)
MNDEMSIESYLAAGGVLSNPSNVPPRYRAELMTIMASFVDSALAGAAGFVDIINEGPGIK
SRMAAARIVLEKTANADRVLQVMGDFGADTERYVDHHPWTARLDRDAGLDQSRSKHDRRL
AVFNYPLEGWADAVVMNLLMGRAVAVQLAELSMISYQPLAEAFRSIQPVEAHHARLAHEG
LARLVQEGDISMLTESIHYWWPRVAISFGTDASDKFETLSALGLRHRSNSDLRTRWQSEM
RGVLRELGLDAPEPA