Protein Info for Psest_3987 in Pseudomonas stutzeri RCH2

Annotation: Nitroreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00881: Nitroreductase
  • amino acids 7 to 177 (171 residues), 116.2 bits, E=1.8e-37

Best Hits

Swiss-Prot: 50% identical to DRGA_SYNY3: Protein DrgA (drgA) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 95% identity to psa:PST_0294)

Predicted SEED Role

"Oxygen-insensitive NAD(P)H nitroreductase (EC 1.-.-.-) / Dihydropteridine reductase (EC 1.5.1.34)" in subsystem Pterin biosynthesis (EC 1.-.-.-, EC 1.5.1.34)

MetaCyc Pathways

• L-phenylalanine degradation V (3/3 steps found)
• tetrahydropteridine recycling (2/2 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Folate biosynthesis
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-, 1.5.1.34

Use Curated BLAST to search for 1.-.-.- or 1.5.1.34

Sequence Analysis Tools

See L0GR48 at UniProt or InterPro

Protein Sequence (200 amino acids)

>Psest_3987 Nitroreductase (Pseudomonas stutzeri RCH2)
MNTEEAIRSRRAVKAYDPSFQLSREEKDELLQLALLAPSAFNLQHVRLVEVSDPALRAQI
REVGWNQAQMTDASMLVVICAQIDSWEKDVRRVWDGAPSEVQDFMAGAIDAYYRGKPQVQ
RDETMRSCGLMAQTLMLAARAKGLDSCPMDGFDFDAVGKLINLPDNHVIALMVAVGKRAA
EPKPRIGKLPFDEVVIRDRF