Protein Info for HP15_3855 in Marinobacter adhaerens HP15

Annotation: 2,4-diaminobutyrate 4-transaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 TIGR02407: diaminobutyrate--2-oxoglutarate aminotransferase" amino acids 2 to 411 (410 residues), 634.1 bits, see alignment E=8.2e-195 TIGR00709: 2,4-diaminobutyrate 4-transaminase" amino acids 3 to 416 (414 residues), 456.8 bits, see alignment E=6.7e-141 PF00202: Aminotran_3" amino acids 16 to 408 (393 residues), 261 bits, see alignment E=8.1e-82

Best Hits

Swiss-Prot: 58% identical to ECTB_VIBPA: Diaminobutyrate--2-oxoglutarate transaminase (ectB) from Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633)

KEGG orthology group: K00836, diaminobutyrate-2-oxoglutarate transaminase [EC: 2.6.1.76] (inferred from 92% identity to maq:Maqu_0148)

Predicted SEED Role

"Diaminobutyrate-pyruvate aminotransferase (EC 2.6.1.46)" in subsystem Ectoine biosynthesis and regulation (EC 2.6.1.46)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.46 or 2.6.1.76

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJ21 at UniProt or InterPro

Protein Sequence (422 amino acids)

>HP15_3855 2,4-diaminobutyrate 4-transaminase (Marinobacter adhaerens HP15)
MEIFKSTESEVRVYSRAFPVIFNRAKNAHLYTEDGKEYLDFLAGAGSLNYGHNNDTLKKA
LLEYIEADGVSQGLDMFTTAKHDFMESYKKHILDPRGLDYKMQFTGPTGTNCVEAALKLA
RKVKGRSGIISFTNGFHGVTMGAVATTGNKHHRGGVGTPLGNVDFMFYDGYLGDDVDTLA
IMDKLLSDGSSGFELPAAVIVEAVQGEGGLNACRAEWLKGLSELCKKHDILLILDDIQAG
NGRTGEFFSFEFAGIKPDIVTVSKSLSGYGLPMALVLFKPELDVWDPGEHNGTFRGNNMA
FITARAAVENYWKDDAFANEVKAKTEVLGDALQSICDKYPGQFKMKGRGLMRGIEAKHAD
ITGPITKRAFEHGLIIETSGPNDEVIKCLMPLTTSEEDLKKGAALLAKSVDEIMQEGLSE
AS