Protein Info for PGA1_65p00170 in Phaeobacter inhibens DSM 17395

Annotation: putative capsular polysaccharide biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 615 transmembrane" amino acids 44 to 64 (21 residues), see Phobius details amino acids 71 to 98 (28 residues), see Phobius details amino acids 104 to 129 (26 residues), see Phobius details PF13727: CoA_binding_3" amino acids 105 to 226 (122 residues), 37.1 bits, see alignment E=1.1e-12 PF04321: RmlD_sub_bind" amino acids 275 to 519 (245 residues), 42 bits, see alignment E=2.3e-14 PF02719: Polysacc_synt_2" amino acids 275 to 565 (291 residues), 380.9 bits, see alignment E=1.4e-117 PF01370: Epimerase" amino acids 275 to 495 (221 residues), 76.4 bits, see alignment E=8.2e-25 PF01073: 3Beta_HSD" amino acids 276 to 406 (131 residues), 33.5 bits, see alignment E=8.2e-12 PF16363: GDP_Man_Dehyd" amino acids 276 to 402 (127 residues), 41.1 bits, see alignment E=5.5e-14

Best Hits

KEGG orthology group: None (inferred from 72% identity to dsh:Dshi_3857)

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E6W5 at UniProt or InterPro

Protein Sequence (615 amino acids)

>PGA1_65p00170 putative capsular polysaccharide biosynthesis protein (Phaeobacter inhibens DSM 17395)
MISGAISGHIKRPPQVYAVTGDWKWGRPGMFNLISALSRKQKSYIFLTIDLGLIPLALLL
TFLVQPLPGSALATLAAMLPVLPYVLAVSAGVALWLGLPPGTHVVFATTYFLCLLAARAV
LYQVVVAIYRRAQPRCRVLIYGAGTTGAQLAQALKAHDGIDPVAFVDDNTSLQGVTLVGL
PVFPPARIAEIAEARQIKRVLLAMPSQSQPKQAQIIQRLQRMQLEVQALPSFAQLIGEEA
LVDKLTPVAPQNFLGRATRDVPLQEASGSYQDRVVLVSGAGGSIGSELCRQVLACRPRKL
VLYELSELALYTIHQELEQQVEGTGITLVPVLGSVTDPRQVRMVLAHHGVQVVLHAAAYK
HVPLVEANPLPGLANNVFGTQTLARAAARSGVERFILISSDKAVRPTNVMGASKRMAELV
VQDLSTRNPGTVFTMVRFGNVLGSSGSVVPLFQEQISRGGPVTVTDPRVKRYFMTIREAV
QLVLQAGAEALGGEVFVLDMGEPISILQLARQVIESAGYSVRDEDHPDGDIAIDIIGLRP
GEKMQEELTLSSDLITTRHQKIFCAREAVLSEIEVATLIRGLRQAVAAGDEGVARALIKR
WVEGYRAPEEDRKTS