Protein Info for Psest_3983 in Pseudomonas stutzeri RCH2

Annotation: Aldo/keto reductases, related to diketogulonate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF00248: Aldo_ket_red" amino acids 49 to 295 (247 residues), 136.7 bits, see alignment E=4.6e-44

Best Hits

KEGG orthology group: None (inferred from 90% identity to psa:PST_0299)

Predicted SEED Role

"L-fuco-beta-pyranose dehydrogenase (EC 1.1.1.122)" (EC 1.1.1.122)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.122

Use Curated BLAST to search for 1.1.1.122

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRN4 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Psest_3983 Aldo/keto reductases, related to diketogulonate reductase (Pseudomonas stutzeri RCH2)
MYRRRQFLQGSAVCMAIAALGPLLPALSFAAQGVLRRTIPSSGEALPVIGLGTSITHNTS
LDDPQMERLLEVLRVLVEGGASLIDTAPSYGNAERVVGELVKRHSQRDKVFLASKVSSTG
RERGMAQIEASFQALQTDTIDLIQVHNLQDTSTQLGLLRELKQEGRVRYIGVTHYLESAH
DRLLETLKQEPVDFVQFNYSVSERNAEKQLLPYCADNGIATLINRPFTRGNLLSRVKDKP
LPAWAAEIDASSWAQLLLKFILAEPAVTAVIPATSNPRYMADNLLAGQGRLPDQRQRQLI
VEAFR