Protein Info for HP15_3849 in Marinobacter adhaerens HP15

Annotation: pyridine nucleotide-disulfide oxidoreductase dimerization region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 729 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 48 to 72 (25 residues), see Phobius details amino acids 84 to 108 (25 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 163 to 181 (19 residues), see Phobius details amino acids 200 to 218 (19 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details PF09335: VTT_dom" amino acids 70 to 184 (115 residues), 87.7 bits, see alignment E=4e-28 PF07992: Pyr_redox_2" amino acids 238 to 560 (323 residues), 206.8 bits, see alignment E=2.3e-64 PF01134: GIDA" amino acids 240 to 295 (56 residues), 26.1 bits, see alignment 2e-09 PF13434: Lys_Orn_oxgnase" amino acids 354 to 466 (113 residues), 33.5 bits, see alignment E=1.2e-11 PF13738: Pyr_redox_3" amino acids 365 to 544 (180 residues), 33 bits, see alignment E=1.8e-11 PF00070: Pyr_redox" amino acids 409 to 480 (72 residues), 62.7 bits, see alignment E=1.7e-20 PF02852: Pyr_redox_dim" amino acids 582 to 690 (109 residues), 99.2 bits, see alignment E=7.3e-32

Best Hits

KEGG orthology group: K00520, mercuric reductase [EC: 1.16.1.1] (inferred from 91% identity to maq:Maqu_0145)

Predicted SEED Role

"COG0398: uncharacterized membrane protein / PF00070 family, FAD-dependent NAD(P)-disulphide oxidoreductase" in subsystem Mercuric reductase

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.16.1.1

Use Curated BLAST to search for 1.16.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJ15 at UniProt or InterPro

Protein Sequence (729 amino acids)

>HP15_3849 pyridine nucleotide-disulfide oxidoreductase dimerization region (Marinobacter adhaerens HP15)
MTLKKWILVALIAAVVVGFIASGGSELLTLENLKENQQSLGNWIDQNLLVAVLGFVVVYV
VVTALSLPGATIMTLAGGAFFGNLYGLAAVSVASTIGASLAFLVARFLMRDTLRKRYGET
VAKMDRGIEKDGAFYLATLRLVPVFPFFLINLAMGLTAMKLRTYALVSWIAMLPGTFVYV
NAGTQLGQIQSTGDIVSADLLLSFALLGLFPLIAKFVVGFIRRRKVYAGWQKPEHFDYNL
LVIGGGSAGLVSAYIAAAVKAKVALIEKHKMGGDCLNTGCVPSKALIRSAKAADTLRHAN
RYGLESVPVKGSFKNIMNRVKNVIAKVEPHDSPERYRKLGVDCIAGEASFVSPWELEVRH
NDGRTERLTARSIVVATGGKPAVPPIPGLKDMEPLTSDNLWELQEQPERLLVLGGGPIGS
ELAHAFARLGSKVTQVEMGERLLAKEDEDVSELVLKQFQADGVDVRLKHAAAEFRMEEGE
KVAYCEHEGERVRIPFDQVLVAVGRAANTAGLNLERIGVDTLPNGTVPVEEDMSLRYPNV
FACGDVAGPYQFTHAAAHQAWYAAVNGLFGQFKRFKVDYRVMPWVTFTSPEVARVGLSEA
EATAQGVAYEVTRYGLDDLDRAIAESEDHGFIKVLTPPGKDKILGAVVVGSHAGEILAEF
TLAMKHGLGLNKILGTIHPYPTWNESAKYAAGEWKRAHAPEGIMKLLEKLHGWRRGKNTN
TPRSIYAPD