Protein Info for PGA1_65p00110 in Phaeobacter inhibens DSM 17395

Annotation: putative amino-acid ABC transporter, periplasmic solute-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00497: SBP_bac_3" amino acids 27 to 247 (221 residues), 129.8 bits, see alignment E=5.7e-42

Best Hits

Swiss-Prot: 54% identical to PATH_VIBHA: Putative amino-acid ABC transporter-binding protein PatH (patH) from Vibrio harveyi

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 77% identity to sit:TM1040_3038)

Predicted SEED Role

"Amino acid ABC transporter, periplasmic amino acid-binding portion"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETA0 at UniProt or InterPro

Protein Sequence (258 amino acids)

>PGA1_65p00110 putative amino-acid ABC transporter, periplasmic solute-binding protein (Phaeobacter inhibens DSM 17395)
MMKPFAWAAAVAASLTAAPSAFASDTLRVGMSGGYFPFTFVRQDVLQGFEVDVMNAVAEE
TGLEVEFVTMSFSGLIGALESDRIDTIANQITITPERSAKFAFTQAYVIDGAQVVVKRGN
EDSIAGPADLAGKTVAVNLGSNFEQLLRELPQADKIEIKTYEANIAQDTALGRVDAFVMD
RVSSAQLIQESPLPLALAGAPFSEIRNALPFRQGADSLALRDRVDTALTTLREGGKLAEI
SQKWFGTDITAVSAPAEK