Protein Info for HP15_3843 in Marinobacter adhaerens HP15

Annotation: iron(III) ABC transporter, periplasmic iron-compound-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF01547: SBP_bac_1" amino acids 37 to 286 (250 residues), 54.9 bits, see alignment E=2.9e-18 PF13531: SBP_bac_11" amino acids 40 to 290 (251 residues), 42.3 bits, see alignment E=1.5e-14 PF13416: SBP_bac_8" amino acids 41 to 309 (269 residues), 69.2 bits, see alignment E=1.1e-22 PF13343: SBP_bac_6" amino acids 75 to 306 (232 residues), 80.7 bits, see alignment E=2.4e-26

Best Hits

Swiss-Prot: 56% identical to IDIA_THEEB: Iron deficiency-induced protein A (idiA) from Thermosynechococcus elongatus (strain BP-1)

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 67% identity to csa:Csal_0549)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PJ09 at UniProt or InterPro

Protein Sequence (340 amino acids)

>HP15_3843 iron(III) ABC transporter, periplasmic iron-compound-binding protein (Marinobacter adhaerens HP15)
MVSHKAKLAAAALATTLAATSVSASEVNLYSARHYDSDQAIYNAFTEETGIKVNLIEGKS
DALIQRIQREGVASPADILITVDAGNLWRADQEGIFQPVDSEVLNSRLPDSLRHPEGHWF
GFSQRLRVIYYDRSDFDPSRISQYEDLAKPEFKGEICIRSSSNIYNQSLLASLVEYHGEE
GAEEWAQGVVNNMARDPQGGDTDQIRAVAAGECNLAVGNHYYYARLLNSDDVADREVARE
VGIIFPNQDGRGVHANIGGAGVVATAPNKDNAIRFLEFLSSDTAQQIFAESNHEFPAVEG
VLKNPVLDSWGNLNIDDINVSVLGTNNPEAVKIFDRVGWR