Protein Info for PGA1_65p00030 in Phaeobacter inhibens DSM 17395

Annotation: putative type I secretion system ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 587 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 48 to 70 (23 residues), see Phobius details amino acids 120 to 143 (24 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 215 to 232 (18 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details TIGR01842: type I secretion system ATPase" amino acids 11 to 547 (537 residues), 591.6 bits, see alignment E=7.1e-182 PF00664: ABC_membrane" amino acids 17 to 271 (255 residues), 40.4 bits, see alignment E=4.5e-14 PF00005: ABC_tran" amino acids 341 to 487 (147 residues), 96.8 bits, see alignment E=2.5e-31

Best Hits

KEGG orthology group: K06148, ATP-binding cassette, subfamily C, bacterial (inferred from 42% identity to rru:Rru_B0039)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F522 at UniProt or InterPro

Protein Sequence (587 amino acids)

>PGA1_65p00030 putative type I secretion system ATPase (Phaeobacter inhibens DSM 17395)
MKTKRVFDGQRGVITSIFVASIFVNLLVLTAPLYMLQLFARVMASGSMPTLIALTTGAAI
ALVFFFLFDVIRQRLVARLGSRLEARLSPVVLQGMISGNLPAPLRTAEPIRDIQDLRGFV
TSPVFIALLDAPWSLLFIALIFVFSPILGLVSVAGLLILLGLGVLSELMGRGPGKTSEEA
ARETNAAVDEMMVNAEIIHAMGKTSAQIGRWRGRAFTAILFGTLVTDRVALMTSLAKAVR
MGLQIAVLGVGVVLVINNQLTPGLMIASSILLGRAAAPVEQSIAGWRALLKARSAKERLN
LLLAHAEDTSDRMELPDPTGRLSVENATVVLPGRQDPLLLDITLSLQPGHALGLIGPSGA
GKTTLARALVGLQPLVRGHVRIDDAALTDWDPEQIGRHIGFLPQQVDLFRGSVAENIAMM
DPTSKPSDVVAAAKLARVHELILTLPGGYNAEVGPRGSFLSAGQRQRIGLARAFFGERKL
IVLDEPNANLDPEGEEALAAAIEEACARGAIVVVVTHRLNLLRRVSHAALIQEGRIARFG
EARQIIEAAAQPMSRAQGDPKVTNLAPRRAAQNGTNAEAGATEGAQS