Protein Info for PGA1_78p00590 in Phaeobacter inhibens DSM 17395

Annotation: PRC-barrel domain.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF05239: PRC" amino acids 36 to 112 (77 residues), 28.3 bits, see alignment E=7.5e-11 amino acids 203 to 262 (60 residues), 25.2 bits, see alignment E=6.6e-10

Best Hits

Predicted SEED Role

"Hydrogenase maturation factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F520 at UniProt or InterPro

Protein Sequence (289 amino acids)

>PGA1_78p00590 PRC-barrel domain. (Phaeobacter inhibens DSM 17395)
MKNLLLSTAIALTPATAVLADGHGDMFRAEADPMAIHASEFIGMRVYRAEGGQDATEYAG
VQKEWDDIGEINDVVLNRDGTVDSVLVDIGGFLGMGENQVAVDMKSVKFVADSSTAEDLS
DFFLVMDASTEALKEAPTYDWTRQVSADVEEMKQETAAAAGEIKDDADALATDAEQTAEN
AVDAAKDPFTRDGFVAASMTDLTSEQLTGAPLYDSKDEWIGEVSQINLTSDGKVKSIVAD
IGGFLGLGEKPVELELSKMDILRADDGDDLRAYVSMSKEELEQLPDYEQ