Protein Info for Psest_3963 in Pseudomonas stutzeri RCH2

Annotation: PAS domain S-box

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 853 PF08447: PAS_3" amino acids 230 to 294 (65 residues), 50 bits, see alignment 8.7e-17 TIGR00229: PAS domain S-box protein" amino acids 309 to 433 (125 residues), 50.4 bits, see alignment E=1.2e-17 PF00989: PAS" amino acids 316 to 423 (108 residues), 23.7 bits, see alignment E=1.2e-08 PF08448: PAS_4" amino acids 320 to 426 (107 residues), 71.3 bits, see alignment E=2.3e-23 PF00512: HisKA" amino acids 482 to 546 (65 residues), 33.8 bits, see alignment 8.5e-12 PF02518: HATPase_c" amino acids 590 to 708 (119 residues), 70.2 bits, see alignment E=5.9e-23 PF00072: Response_reg" amino acids 734 to 843 (110 residues), 74.3 bits, see alignment E=2.6e-24

Best Hits

KEGG orthology group: None (inferred from 90% identity to psa:PST_0316)

Predicted SEED Role

"PAS/PAC sensor hybrid histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GRL4 at UniProt or InterPro

Protein Sequence (853 amino acids)

>Psest_3963 PAS domain S-box (Pseudomonas stutzeri RCH2)
MAAVGAELWPHSHSEMSERIRRFDWGATVLGAPDTWPPALRLLLDTLLEAPLPMCILWGE
QALQLYNDAHAALIGDRHPAELGQPACHRWGATWELLNPACDTARRGEPRVLRNQQLAIE
REGVLEQAWFDLALSPIRDTPRSIGGLLLCLSETSERVRTETRLSQTALHYKLSAEVHRA
SEQRLQLALEASDLIGIWDWAIQSSEIPPGAELSRILPVAQSGPKGLSSEAFFDHVHPDD
VPRLRAALQRCITERGNLDERYRLRGENGATRWALARGRCHCDEQGRPLRFPGAVMNITS
QQASEDALRQREAELKMITDALPVLIGYIDSEERFRFNNRYYTEWFGHSTEWLLGKTARE
VLGERGYAERQVNIRAALAGQDVTFEAYSPHRDGQPRRMLVHYLPRRDCHANVLGFFVMA
LDVTERWRAEQALRELNETLESRIQERTQALAEVYERLLKEMASREQAQEALRQAQKMEA
VGQLTGGIAHDFNNMLTGIIGGLDLIQRYIQSGRHGETQRFIDAAVTSANRAAALTHRLL
AFARRQPLNLKRVELNQLIESMHDLLSRTLGRHIHIDNRLQQGLWPVSSDENQLESALLN
LVINARDAMPDGGSLLLETRNVELYSQGEVGDLAAGRYVILRLTDSGCGMSAKVLASVFE
PFFTTKPIGQGTGLGLSMVYGFTRQAGGHIQIASEPGEGTQVSLYLPVYEEEGVAALPAK
EIEGPLRAKQGETVLVVEDDPAVRLLVIDVLEMLGYQALEAADGNAAIRILESSAAVDML
VTDVGLPGMNGRQLADAARQQRPGLPVLFMTGYAKQAASSDFLEPGMDMISKPFNLDALA
KRVCDMLMENDQR