Protein Info for Psest_3960 in Pseudomonas stutzeri RCH2

Annotation: 3'(2'),5'-bisphosphate nucleotidase, bacterial

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00459: Inositol_P
  • amino acids 5 to 245 (241 residues), 154.6 bits, E=1.9e-49
• TIGR01331: 3'(2'),5'-bisphosphate nucleotidase
  • amino acids 6 to 254 (249 residues), 281.7 bits, E=2.9e-88

Best Hits

Swiss-Prot: 51% identical to CYSQ_ECO57: 3'(2'),5'-bisphosphate nucleotidase CysQ (cysQ) from Escherichia coli O157:H7

KEGG orthology group: K03677, CysQ protein (inferred from 86% identity to psa:PST_0319)

MetaCyc: 50% identical to 3'(2'),5'-bisphosphate nucleotidase (Escherichia coli K-12 substr. MG1655)
3'(2'),5'-bisphosphate nucleotidase. [EC: 3.1.3.7]

Predicted SEED Role

"3'(2'),5'-bisphosphate nucleotidase (EC 3.1.3.7)" (EC 3.1.3.7)

KEGG Metabolic Maps

• Sulfur metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.7

Sequence Analysis Tools

See L0GT03 at UniProt or InterPro

Protein Sequence (272 amino acids)

>Psest_3960 3'(2'),5'-bisphosphate nucleotidase, bacterial (Pseudomonas stutzeri RCH2)
MNHPYLSSVIDLVRQAGAVILPHWRSELAVQAKADDSPVTAADMAAHRVLADGLRALDGA
IPVLSEEDCELSLAERASWTRWWLVDPLDGTKEFIAGSEEFTVNVALIEEGKVRFGVVGI
PASGRCYYGGEDFGAWRSEADGAAEPLRVRRQPVDAFTVVASRRHSSPAQEQLLGRLGER
FGELALANVGSSLKFCLLAEGAADCYPRLAPTSQWDTAAAQGVLEGAGGEVLDVSGVPLR
YEARASYLNPSFLALPKDVDWRDWLIELANRG