Protein Info for HP15_377 in Marinobacter adhaerens HP15

Annotation: translation elongation factor G

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 701 TIGR00484: translation elongation factor G" amino acids 1 to 700 (700 residues), 1196.3 bits, see alignment E=0 PF00009: GTP_EFTU" amino acids 8 to 287 (280 residues), 212 bits, see alignment E=1.4e-66 TIGR00231: small GTP-binding protein domain" amino acids 10 to 187 (178 residues), 116 bits, see alignment E=1.4e-37 PF03144: GTP_EFTU_D2" amino acids 330 to 397 (68 residues), 65.8 bits, see alignment E=9.6e-22 PF14492: EFG_III" amino acids 410 to 484 (75 residues), 118 bits, see alignment E=3.7e-38 PF03764: EFG_IV" amino acids 485 to 608 (124 residues), 148.9 bits, see alignment E=1.5e-47 PF00679: EFG_C" amino acids 611 to 695 (85 residues), 107.5 bits, see alignment E=7.4e-35

Best Hits

Swiss-Prot: 91% identical to EFG_MARHV: Elongation factor G (fusA) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K02355, elongation factor G (inferred from 91% identity to maq:Maqu_0716)

Predicted SEED Role

"Translation elongation factor G" in subsystem Translation elongation factor G family or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLY5 at UniProt or InterPro

Protein Sequence (701 amino acids)

>HP15_377 translation elongation factor G (Marinobacter adhaerens HP15)
MARKTPIKRYRNIGICAHVDAGKTTTTERVLFYTGISHKIGEVHDGAATMDWMEQEQERG
ITITSAATTTFWQGMDKQYPEHRINIIDTPGHVDFTIEVERSLRVLDGAVVVFCGSSGVE
PQSETVWRQANKYEVPRMVFVNKMDRAGANFLRVVEQIKKRLGANCVPIQLPIGAEDNFA
GIVDLIRNKAIYWNEADSGATYEQKDVPAEMEDEVAMYREQMVEAAAEANEELMEKYLEE
GELSIDDIKKGLRMRTLANEIVVATCGSAFKNKGVQAVLDSVIEFLPAPDEVKAIRGEVD
EDGTEELREADDDAPFAALAFKIATDPFVGTLTFFRVYSGKLESGNAVYNSVKGKKERVG
RMVQMHSKDRQEIKEVLAGDIAAAIGLKSVTTGDTLCDENHKIILERMEFPEPVISVAVE
PKSKADQEKMGVALGKLAQEDPSFRVRTDEESGQTIISGMGELHLDIIVDRMRREFKVEA
NIGKPQVAYRERIRKSVDVEGKFVRQSGGRGQYGHVKIKLEPLPLDDEDGENFIFVNEIV
GGVVPKEYIPAVQQGIEEQMQNGCLAGYPLLRIKATLYDGSYHDVDSNEMAFKVAGSMAM
KKGALEANPALLEPIMRVEVVTPEDYMGDVVGDLNRRRGVIQGMDEGPAGKVIRAEVPLS
EMFGYATDLRSATQGRASYAMEFSGYSEAPSNIAEAIIKKG