Protein Info for PGA1_78p00520 in Phaeobacter inhibens DSM 17395

Annotation: putative secretion protein, HylD family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 transmembrane" amino acids 105 to 125 (21 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 155 to 451 (297 residues), 145.8 bits, see alignment E=7.5e-47 PF25917: BSH_RND" amino acids 168 to 295 (128 residues), 38 bits, see alignment E=2.9e-13 PF25973: BSH_CzcB" amino acids 171 to 294 (124 residues), 34.4 bits, see alignment E=4.2e-12

Best Hits

Predicted SEED Role

"Membrane-fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ET79 at UniProt or InterPro

Protein Sequence (468 amino acids)

>PGA1_78p00520 putative secretion protein, HylD family (Phaeobacter inhibens DSM 17395)
MATPLHANQQGRAEGVRGDTASPAGSAAAVPPVSAVNETSPTSQVAETPAPTVPPAAPDP
QVNRSATAAVAQPASAPQPPGCVGGADPAGLEFVSDPEARWPPRLAAMICAGLVIWMAVG
LVWPAAPVTADDEAGTPSIEPVSVAVRLSQAAPVTRMLRAEGVSKPDRDATLRAEMSGHV
ASVAVAKGAQVEAGQLLASLQPAQRTASLARAEASLLRAERDHTRAAALHQRGSTTEQRL
SEAREALAVAKADLAAARQSLAETRITAPFAGHLEEFDLTPGAYVQEGAAVARVVALDPL
RVSFQVPQHQRGALRAGAVAQVRFLDGDSAEGRLSFLGQSAQADTRSFAAEVMLDNPSPS
HAPPIPAGISARIAVPLDIVQAHFLSPALLSLDMAGVLGIKSVDDADRVVFTPVEIVQSE
RDGVWVSGLPDQLRLITVGQGFVTAGEVVRPREAAATTGRAAGAEDRR