Protein Info for HP15_3829 in Marinobacter adhaerens HP15

Annotation: sodium/hydrogen exchanger

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 574 transmembrane" amino acids 7 to 36 (30 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 88 to 110 (23 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 158 to 175 (18 residues), see Phobius details amino acids 181 to 208 (28 residues), see Phobius details amino acids 219 to 236 (18 residues), see Phobius details amino acids 242 to 259 (18 residues), see Phobius details amino acids 271 to 289 (19 residues), see Phobius details amino acids 297 to 321 (25 residues), see Phobius details amino acids 332 to 353 (22 residues), see Phobius details amino acids 359 to 379 (21 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 12 to 385 (374 residues), 185 bits, see alignment E=2e-58 PF03471: CorC_HlyC" amino acids 494 to 568 (75 residues), 36.1 bits, see alignment E=5.2e-13

Best Hits

Swiss-Prot: 52% identical to NHAP2_PSEPG: K(+)/H(+) antiporter NhaP2 (nhaP2) from Pseudomonas putida (strain GB-1)

KEGG orthology group: K11105, cell volume regulation protein A (inferred from 89% identity to maq:Maqu_0122)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIZ5 at UniProt or InterPro

Protein Sequence (574 amino acids)

>HP15_3829 sodium/hydrogen exchanger (Marinobacter adhaerens HP15)
MDPTLTLIGALMLVISIVLSPLSSRVGMPVLLIFLVVGMMMGEDGPGGIQFDDFELAFLI
ANLALGVILLDGGMRTRAETFRVGLKPALVLATLGVAMTAAGAAVVAWWVFDLHWLTALL
IGAIISSTDAAAVFSLLQGRGLHLNERVSATLEIESGSNDPMAIFLTLMLVTLIGNDGDH
AGWAVLTMLVQQFGVGAVAGIIGGFAVVELANRIRLTPSLYPLLVAAAGISVFSATNALG
GSGFLAIYLTGVVIGNRHVRMMPMILQVHDGLAWLAQLCLFLMLGLLVTPSDLIPLAGGG
LILALSLIFIIRPLTVMLTLWPFAFNRRELGFISWVGLRGAVPIVLALFPIIADLPEAQL
VFHAAFFIVLVSLLVQGTTMTPLARKLRLEVPAGEDPYRRLPLDAPAAGDHELMLFPLRG
EIWETPRRLSQLRLPENTAVAGVFRNRVCLQPKADLEVSSGDMVAMFATPSVLPELGKAL
SGRHAPKYLAERAFFGDFVLNGDALLGDVEQVYGIEFDDLPPELSLAECFARRTKGHPVV
GDVVTLGPVTLVARATSADQVTKVGLKMDNSQNG