Protein Info for PGA1_78p00500 in Phaeobacter inhibens DSM 17395

Annotation: putative transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 151 to 178 (28 residues), see Phobius details amino acids 199 to 225 (27 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details PF12833: HTH_18" amino acids 319 to 397 (79 residues), 59.7 bits, see alignment E=2.9e-20 PF00165: HTH_AraC" amino acids 358 to 396 (39 residues), 36.7 bits, see alignment 3.5e-13

Best Hits

Predicted SEED Role

"transcriptional regulator, AraC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DX22 at UniProt or InterPro

Protein Sequence (406 amino acids)

>PGA1_78p00500 putative transcriptional regulator (Phaeobacter inhibens DSM 17395)
MRIERAMVDDKYLLALSAFHLGMALFCTNQLLLHQRHQRVYVPLALFFITQSVTEMLGIL
DLVVVDDAYDYLVARFNSLHVPAVFAQPLLLWLYVRGLTSEDDGPPVTQRFWHAVPILLA
ISMVVLFWTIPKSLFAQNDLEFADLSQYIKAILIYFQLVEALFYIQVALYLVLIMKMLSR
YRARLKDLFATTEDRELTWVWWITTTVGAYLLISVAEILADLFGIEMFQLFSEASDLTSG
LSSLAITWVIGIWGVRQQPGLMPKPVGNTPPATERELAAAKYERSALTDDHAARIAAKIE
RAMTKDMLYRDPNLSLWDLAKHISVTSNYVSQTLNMTLQSNFFDYVNKWRIQDAVTQLHD
TDETILVIAHDVGFNSRSSFYNAFKREMNTTPSALRASRAAADPAS