Protein Info for Psest_3951 in Pseudomonas stutzeri RCH2

Annotation: proline iminopeptidase, Neisseria-type subfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 TIGR01249: prolyl aminopeptidase" amino acids 9 to 309 (301 residues), 422.4 bits, see alignment E=5e-131 PF00561: Abhydrolase_1" amino acids 36 to 296 (261 residues), 125 bits, see alignment E=6.3e-40 PF12697: Abhydrolase_6" amino acids 37 to 295 (259 residues), 47.4 bits, see alignment E=6e-16 PF12146: Hydrolase_4" amino acids 61 to 294 (234 residues), 43.2 bits, see alignment E=4.7e-15

Best Hits

Swiss-Prot: 59% identical to PIP_XANCI: Proline iminopeptidase (pip) from Xanthomonas citri

KEGG orthology group: K01259, proline iminopeptidase [EC: 3.4.11.5] (inferred from 95% identity to psa:PST_0329)

Predicted SEED Role

"Proline iminopeptidase (EC 3.4.11.5)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 3.4.11.5)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSR9 at UniProt or InterPro

Protein Sequence (324 amino acids)

>Psest_3951 proline iminopeptidase, Neisseria-type subfamily (Pseudomonas stutzeri RCH2)
MQTLYPEIKPYARHELAVEEPHVLYVDESGSPDGLPVLFVHGGPGGGCDAMSRRFFDPSL
YRIITFDQRGCGRSTPHASLENNTTAHLIADMQRIREHLGIDKWVLFGGSWGSTLSLAYA
QTYPEHVHALILRGIFLCRPQDLAWFYQEGASRLFPDYWQDFLSPIPPEERDDLMQAFHR
RLTGTDQIAQMHAAKAWSCWEGRTATLRPNNQVVDRFADTHRALSMARIECHYFVNQAFL
EPDQLLRDMPKIAHLPGIIVHGRYDAICPLDNAWALHQAWPNSELQIIRDAGHSAAELGI
ADALVRAAGEIAHRLLDLPPADAE