Protein Info for PGA1_78p00430 in Phaeobacter inhibens DSM 17395

Annotation: putative AMP-dependent synthetase and ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 PF00501: AMP-binding" amino acids 82 to 273 (192 residues), 56.5 bits, see alignment E=2.2e-19 PF13193: AMP-binding_C" amino acids 339 to 410 (72 residues), 26.9 bits, see alignment E=7.7e-10

Best Hits

Predicted SEED Role

"Long-chain-fatty-acid--CoA ligase associated with anthrachelin biosynthesis" in subsystem Heme, hemin uptake and utilization systems in GramPositives

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E6T1 at UniProt or InterPro

Protein Sequence (434 amino acids)

>PGA1_78p00430 putative AMP-dependent synthetase and ligase (Phaeobacter inhibens DSM 17395)
MFVLNDTPLDPTALHPRLQQALGDDLHHRYALRMRDTGLGLATLLYLKDHKAGVFPIHAD
IPAEAAKQMATKAGCDWFLEDNLVPQPLPRQPGQTASTRPGAGVLVQMSSGTTGAAKVIT
RSWSSITTEVRHYADFFASAAKMTPVIACPVTHSYGLIPGVLVALHRGHVPVIIDAVNPK
YVLRRLREVSNPVLYTSPAMLHTLAKLLPRDETLNAAVTSGTVLPDPWFQLIRARTRHLF
QQYGCSEVGCIAINQDLQAPCEVGHPLPHLDLQAGAPDTPGPVRVQLTTGGPATTDAAGG
NWVETGDLGYLAADGGLVFTARADDMINVAGLNVYPQDVERAVMGLPGVEDAVAFRLPDP
QAGARVGLLFVSATLSETQLRAQCADLLADHQKPALLRRLPALPRQANGKISRRDIAERY
ASGTDHTADQQVPA