Protein Info for HP15_3820 in Marinobacter adhaerens HP15

Annotation: major facilitator superfamily MFS_1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 42 to 61 (20 residues), see Phobius details amino acids 73 to 90 (18 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 200 to 220 (21 residues), see Phobius details amino acids 233 to 253 (21 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details amino acids 289 to 311 (23 residues), see Phobius details amino acids 322 to 344 (23 residues), see Phobius details amino acids 355 to 373 (19 residues), see Phobius details PF07690: MFS_1" amino acids 12 to 274 (263 residues), 60.5 bits, see alignment E=1.4e-20 amino acids 211 to 388 (178 residues), 62.7 bits, see alignment E=3.1e-21 PF05977: MFS_3" amino acids 240 to 391 (152 residues), 33.7 bits, see alignment E=1.5e-12

Best Hits

KEGG orthology group: None (inferred from 85% identity to maq:Maqu_0112)

Predicted SEED Role

"FIG00784010: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIY6 at UniProt or InterPro

Protein Sequence (427 amino acids)

>HP15_3820 major facilitator superfamily MFS_1 (Marinobacter adhaerens HP15)
MTRMVTSLSALILSIILLVSGNAFLMTLLGIRLSIEAISPDIIGWILVCYSIGFVLGTLY
VHRIIGRVGHIRAFAVFAAAAAVTSLLYPMAVSEIFWAVLRVLSGFSIAGVLVVIESWFS
SRATNANRGALFAVYQIVFYLSAAGGQLIVNIGDPANFMPFSIAAILLALALMPLALTKM
EAPVIEQVQRISIFTLARESFSGVAGALICGVMIGGFYALGPVYATLVGLDVARTSTFMA
SAIVAAMILAWPLGRLCDRFDRRRVMFWIALVAASAAGGVGVLGAENAWLLTLLVGVFTG
LSAALYPVAVAITNDRMESTRIVAASATLLLSYGVGSVIGPVVMAELINLLGPKGLFFGN
AGFLLLLAVITSYRISHTEDVAVADQEHFVPAMPEASPVLAEIDPRNSEFHESPEVEEMH
EEQRQAS