Protein Info for Psest_3947 in Pseudomonas stutzeri RCH2

Annotation: Twin arginine targeting (Tat) protein translocase TatC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 267 transmembrane" amino acids 24 to 47 (24 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 112 to 141 (30 residues), see Phobius details amino acids 161 to 186 (26 residues), see Phobius details amino acids 198 to 214 (17 residues), see Phobius details amino acids 220 to 240 (21 residues), see Phobius details TIGR00945: twin arginine-targeting protein translocase TatC" amino acids 13 to 230 (218 residues), 255 bits, see alignment E=3.3e-80 PF00902: TatC" amino acids 16 to 225 (210 residues), 245.5 bits, see alignment E=2.4e-77

Best Hits

Swiss-Prot: 81% identical to TATC_AZOCH: Sec-independent protein translocase protein TatC (tatC) from Azotobacter chroococcum mcd 1

KEGG orthology group: K03118, sec-independent protein translocase protein TatC (inferred from 94% identity to psa:PST_0333)

MetaCyc: 65% identical to twin arginine protein translocation system - TatC protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-181

Predicted SEED Role

"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQZ4 at UniProt or InterPro

Protein Sequence (267 amino acids)

>Psest_3947 Twin arginine targeting (Tat) protein translocase TatC (Pseudomonas stutzeri RCH2)
MSQSSIDDQEMPLVAHLTELRKRLLRCVVAIALLFGGLFYFSQQIYALVAAPLRAYLPEG
ATMIATGVASPFLTPFKLTLMVALFLSMPVILHQIWGFIAPGLYKHEKRIAVPLLVSSIF
LFYAGMAFAYFVVFPIMFGFFASVTPEGVAMMTDIGQYLDFVLTLFFAFGVAFEIPVATF
LLIWVGIVDVATLRKSRPYVIVGCFAVGMVLTPPDVFSQALLAVPMWLLFEAGVICGSLV
KKRDPHFRGDAEDEAPETGDQPPAPRP