Protein Info for PGA1_78p00400 in Phaeobacter inhibens DSM 17395

Annotation: tonB dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 664 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF07715: Plug" amino acids 60 to 156 (97 residues), 44.7 bits, see alignment E=1.7e-15 PF00593: TonB_dep_Rec_b-barrel" amino acids 216 to 628 (413 residues), 112.9 bits, see alignment E=3.7e-36

Best Hits

Predicted SEED Role

"Outer membrane receptor proteins, mostly Fe transport" in subsystem Hemin transport system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DX09 at UniProt or InterPro

Protein Sequence (664 amino acids)

>PGA1_78p00400 tonB dependent receptor (Phaeobacter inhibens DSM 17395)
MAHTTAHKSSILLTGLLCSTALTVFSATKGHAEDDGVLSLDPIIVKQRDADGDAADRATA
VYVADAEIERAAMGDLKDLFAGIASVSVGGAIPVAQKIYVNGIDMLKLAVQVDGVSQNNR
VFHHASANAFDPGLMKSVRVDPGVAPADAGPGALAGRVVMETIDAEDILTEGQAIGGKTR
LSYGENGDTFGTSLTLAGQSNGFEILLYGKRMTGDDYTDGAGNTVGGTRSDLTAGLLKLA
YETDTGHRFEFSGQQMQDTALRNRRANFGTASFNPLDTVYDTKRTVYSLRYEDVNGGGNW
DPSATIGFSENEIGSRRTAETSVGVTRTYSATFQNRFHLSESDTITAGIDFQDQKSSASG
DYWGANRPSETSQTIGVFAQARLQPSDRLKVSAGLRYDWNAFTGQDFGQSGRPYEQDSSG
LSGNLSIVYDVNDALSLRAGYSNVFGGIGIEDNFLFFRDWDYSALKPRRASNVVVGADWQ
SGNWTLGAEAFQTKIDDTRDVAGPTVTSYDFESRGYNLGATYGWDSGFARLTFTDSETRV
NGAATSSYYVLDSGAPIGQVLALEVQQELPQWDLVVGGHIDAAFDYDQQLNEADATTQLE
GYEVLNLFAEYRPAAYDNVTIRAEINNVFDRQYADRATYGGDYPGFATLKEPGRSVSLVA
NVSF