Protein Info for Psest_3944 in Pseudomonas stutzeri RCH2

Updated annotation (from data): phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)
Rationale: Important for fitness in most defined media. Semi-automated annotation based on the auxotrophic phenotype and a hit to HMM TIGR03188.
Original annotation: phosphoribosyl-ATP pyrophosphohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03188: phosphoribosyl-ATP diphosphatase
  • amino acids 5 to 92 (88 residues), 96.7 bits, E=3.7e-32
• PF01503: PRA-PH
  • amino acids 6 to 95 (90 residues), 54.2 bits, E=7.8e-19

Best Hits

Swiss-Prot: 98% identical to HIS2_PSEU5: Phosphoribosyl-ATP pyrophosphatase (hisE) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01523, phosphoribosyl-ATP pyrophosphohydrolase [EC: 3.6.1.31] (inferred from 98% identity to psa:PST_0336)

Predicted SEED Role

"Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.6.1.31)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.31

Sequence Analysis Tools

See L0GNS9 at UniProt or InterPro

Protein Sequence (110 amino acids)

>Psest_3944 phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31) (Pseudomonas stutzeri RCH2)
MSDTLTRLAEVLEARKGAAPDSSYVASLYHKGLNKILEKVGEESVETILAAKDAAVSGDA
SDLIYETADLWFHSMVMLAALGQHPQAVLDELDRRFGLSGHAEKAARPQT