Protein Info for PGA1_c03980 in Phaeobacter inhibens DSM 17395

Annotation: putative acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 138 PF13673: Acetyltransf_10" amino acids 40 to 110 (71 residues), 29.8 bits, see alignment E=1.1e-10 PF13508: Acetyltransf_7" amino acids 45 to 105 (61 residues), 37.1 bits, see alignment E=6.8e-13 PF00583: Acetyltransf_1" amino acids 45 to 104 (60 residues), 43.8 bits, see alignment E=5.9e-15 PF08445: FR47" amino acids 47 to 107 (61 residues), 29.9 bits, see alignment E=9.3e-11

Best Hits

KEGG orthology group: K03789, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 58% identity to sit:TM1040_3093)

Predicted SEED Role

"Ribosomal-protein-S18p-alanine acetyltransferase (EC 2.3.1.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Ribosome biogenesis bacterial (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-, 2.3.1.128

Use Curated BLAST to search for 2.3.1.- or 2.3.1.128

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ETT9 at UniProt or InterPro

Protein Sequence (138 amino acids)

>PGA1_c03980 putative acetyltransferase (Phaeobacter inhibens DSM 17395)
MARTHQAAFLQGRPWSAREFSALLDSPFSYAVGDARSFALGRVVAGEAELLTIATHPSHQ
RQGLARAILERWREVALTRDATDGFLEVAADNQPARALYKAYGFAESGRRVGYYPRKGAA
AVDAVLMSVSLRKAESPE