Protein Info for HP15_3803 in Marinobacter adhaerens HP15

Annotation: GGDEF domain-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 27 to 45 (19 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 105 to 234 (130 residues), 48.6 bits, see alignment E=8.8e-17 PF13426: PAS_9" amino acids 133 to 225 (93 residues), 33.6 bits, see alignment E=8.1e-12 PF08447: PAS_3" amino acids 135 to 219 (85 residues), 50.6 bits, see alignment E=4e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 234 to 400 (167 residues), 189.7 bits, see alignment E=3.1e-60 PF00990: GGDEF" amino acids 238 to 395 (158 residues), 168.1 bits, see alignment E=2.9e-53

Best Hits

KEGG orthology group: None (inferred from 65% identity to maq:Maqu_0096)

Predicted SEED Role

"putative diguanylate cyclase (GGDEF)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIW9 at UniProt or InterPro

Protein Sequence (409 amino acids)

>HP15_3803 GGDEF domain-like protein (Marinobacter adhaerens HP15)
MAVFMEPSSSKSQGMKSLNENRTPLRRAGWAAVVYLIAGFAWIAFSDTLAETWFPDPKTL
SVIQTWKGSFFVLITGVILFSVLLRQLTKDRALLNLQHRQRQALRERERQLQILMDNLPG
MAYRCLYDPDWTMKFVSQGCTKLTGYEPDELVNNRVTSYAALVSDASNQQLFEQVRVALE
KEESFSLEYEVTRKDGSRIWVWERGRGVQEDDGSLHLEGIILDISDRKVLETELEQMATR
DPLTGLLNRREMSRVLDEELQRARRYQRPMAVLWVDFDHFKDVNDTYGHAAGDSVLRAIS
RLLLGSVRSVDSIGRFGGEEFVIVLPEMDLEEAQETAERLRRKVAEEPQPLGNGEAVPLT
ISVGVAVYPDHGQTASTLCAAADKAMYLAKDRGRNCVAMAHLHDQVHNQ