Protein Info for PGA1_c03970 in Phaeobacter inhibens DSM 17395

Annotation: putative lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF02608: Bmp" amino acids 29 to 317 (289 residues), 209.2 bits, see alignment E=3.7e-66

Best Hits

KEGG orthology group: K07335, basic membrane protein A and related proteins (inferred from 88% identity to rde:RD1_1647)

Predicted SEED Role

"Predicted nucleoside ABC transporter, substrate-binding component" in subsystem D-ribose utilization or Deoxyribose and Deoxynucleoside Catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DLW3 at UniProt or InterPro

Protein Sequence (331 amino acids)

>PGA1_c03970 putative lipoprotein (Phaeobacter inhibens DSM 17395)
MTLMKSLMSAAAAVALTAGAAMAEPALIFDLGGKFDKSFNEAAFAGAQRWAEETGESFRE
IELQSEAQREQALRRFAEAGANPIVMAGFAFADALGQVAADYPDTKFVIIDMVVDAPNVR
SVVFNEHEGSYLVGMLAAKASKSGTVGFIGGMDIPLIRKFACGYAEGVKAANPDATVIAN
MTGTTPAAWNDPVKGSELTKAQISQGADVVYAAAGGTGVGVLQTAADEGILSIGVDSNQN
HLHPGKVLTSMMKRVDNAVFEAFSDGTELETGFSVMGLSNGGVGFAVDDNNASLITEEMT
AATDEAAAKIATGEITVHDYMSDDSCPALSF