Protein Info for PGA1_78p00230 in Phaeobacter inhibens DSM 17395

Annotation: putative NADH-ubiquinone oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 36 to 56 (21 residues), see Phobius details amino acids 68 to 69 (2 residues), see Phobius details amino acids 72 to 95 (24 residues), see Phobius details amino acids 114 to 147 (34 residues), see Phobius details amino acids 167 to 188 (22 residues), see Phobius details amino acids 193 to 220 (28 residues), see Phobius details amino acids 239 to 258 (20 residues), see Phobius details amino acids 264 to 288 (25 residues), see Phobius details amino acids 300 to 326 (27 residues), see Phobius details amino acids 332 to 349 (18 residues), see Phobius details amino acids 362 to 382 (21 residues), see Phobius details amino acids 388 to 409 (22 residues), see Phobius details amino acids 421 to 439 (19 residues), see Phobius details amino acids 457 to 481 (25 residues), see Phobius details PF00662: Proton_antipo_N" amino acids 68 to 111 (44 residues), 36.4 bits, see alignment 4.1e-13 PF00361: Proton_antipo_M" amino acids 128 to 343 (216 residues), 132.1 bits, see alignment E=2.4e-42

Best Hits

KEGG orthology group: K05577, NADH dehydrogenase I subunit 5 [EC: 1.6.5.3] (inferred from 75% identity to sit:TM1040_0832)

Predicted SEED Role

"NADH dehydrogenase, subunit 5" in subsystem Respiratory Complex I

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E6R0 at UniProt or InterPro

Protein Sequence (516 amino acids)

>PGA1_78p00230 putative NADH-ubiquinone oxidoreductase (Phaeobacter inhibens DSM 17395)
MLYLFLPLLAPALLLAVAFRARRSPGRRPAALPRLAEYAGLGAFAVSVMSAVLLMTTGPG
SSPLLGLFGVGLSVRLDVVSVVMLCLVSFIGWIVLRYSATYMDGEARQGAFTGWMAATLA
AVLLLVMSGNLVQLVLAWTATSLCLHQLLLFYRDRTTARRAARKKALVARASELSLAIAA
LLLIMSYGTSDIASILAAAAPDLLTIAAAVLIALAAVLASAQFPTHGWLTEVMEAPTPVS
ALLHAGVINAGGFLLIRFADVMLAAPAVMAVLVMLGGFTALFGGLVMLTQPAVKTSLAWS
TIAQMAFMIMQCGLALFPLALLHIVAHSLYKAHAFLSAGEAVANVAAIRRPGPVAVPSGR
NVMQAFGIGIVIYALVGAVFGFDGKSVQAIALGVILIFGVAYILAQGLADAAPGALTRRT
VIYAAATSVSYFLLQLAALKLTAGTLPATPAPGPLEWALILLALVSFGAVAVAQATFPLW
AMHPAAAGLRVHLSNGLYANAIFDRLLDGWSKRTTA