Protein Info for Psest_3925 in Pseudomonas stutzeri RCH2

Annotation: Methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 545 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details transmembrane" amino acids 190 to 214 (25 residues), see Phobius details PF12729: 4HB_MCP_1" amino acids 5 to 175 (171 residues), 39.5 bits, see alignment E=4.6e-14 PF00015: MCPsignal" amino acids 355 to 510 (156 residues), 157.8 bits, see alignment E=2.5e-50

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 92% identity to psa:PST_0356)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSW9 at UniProt or InterPro

Protein Sequence (545 amino acids)

>Psest_3925 Methyl-accepting chemotaxis protein (Pseudomonas stutzeri RCH2)
MNKQMSVSMRLGLGFLVILGLMVAVAVVSALKVDIIDRSMSQISSQAGLKQRYAINFRGS
VHDRAIAVRDAVSAADPAFARQQVAEIERLAQLYAESAVPMKSMLAQPSADALERQLMGQ
IETIEAKTNALTRQVVELRFNEGSDRAYEFLLENVAGAYSEWLRLINAFIDHQESSINQD
VTVVRETASGFLALIVAVTGVAVLLGVAIAVVIIRKLRSTLGAEPDEVARVIGNLANGDL
GQRIVTPYPDSVMGATAKMASRLTSIIAEVRTAADGVGTASSELLTSSASSNQQIQRQSA
EAEQVATAINQMAATVSEVASFAANAATAAKSADEQVETGTRIVGETAVSIHNLAKVLES
ATDTVNQVSAQSGDIEKILQVITAIAEQTNLLALNAAIEAARAGDHGRGFAVVADEVRSL
ANRTQQSSSEISEMIASLQAGAGRAVEVMQSSKQLAQQTVEQTLQAENALAKIRQEVGAI
NEMNAQIATASEEQSAVAEEVNQSVTRIHDSTVTSSAASNQVAASSQDLTTLAQELNRRV
NYFRG