Protein Info for PGA1_78p00180 in Phaeobacter inhibens DSM 17395

Annotation: putative sn-glycerol-3-phosphate transport system permease protein UgpE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 138 to 160 (23 residues), see Phobius details amino acids 170 to 193 (24 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 275 to 294 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 124 to 293 (170 residues), 54.4 bits, see alignment E=6.8e-19

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 81% identity to mci:Mesci_1696)

Predicted SEED Role

"ABC-type sugar transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E6Q4 at UniProt or InterPro

Protein Sequence (309 amino acids)

>PGA1_78p00180 putative sn-glycerol-3-phosphate transport system permease protein UgpE (Phaeobacter inhibens DSM 17395)
MVDLTPQTPKGSPVRILDGPRGAKPKTRVSRRNVMLYGTLLLIALYYLLPLYVMVVTSLK
GMPEIRLGNIFSPPVEITFQPWIKAWSEACTGINCDGLSRGFGNSIKILVPSVALSIAIA
SVNGYALANWRFKGSETFFTILIIGAFIPYQTMLYPIVIILRELKLMGSLWGLVLVHSIF
GMPILTLLFRNYFSSLPEELFKAARVDGAGFWGIYLRVMVPMSIPIFVVAMILQVTGIWN
DFLFGVIYTKPETYPMTVQLNNIVNSVQGVKEYNVNMAATLLTGLVPLVIYLVSGKLFVR
GIAAGAVKG