Protein Info for Psest_3922 in Pseudomonas stutzeri RCH2

Annotation: Response regulator of citrate/malate metabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF00072: Response_reg" amino acids 7 to 119 (113 residues), 86.2 bits, see alignment E=8.7e-29

Best Hits

Swiss-Prot: 32% identical to DCTR_BACSU: Probable C4-dicarboxylate response regulator DctR (dctR) from Bacillus subtilis (strain 168)

KEGG orthology group: K02475, two-component system, CitB family, response regulator (inferred from 90% identity to psa:PST_0359)

Predicted SEED Role

"Two-component response regulator, malate (EC 2.7.3.-)" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GQW7 at UniProt or InterPro

Protein Sequence (241 amino acids)

>Psest_3922 Response regulator of citrate/malate metabolism (Pseudomonas stutzeri RCH2)
MKNTMRVLIVEDDPMVMRLNVDYLARLDGIELVGQCESVPAALELLEREPVDLLLLDVYL
RNRSGLEVLRHLRAQDRNTDAVLITAASEIETVRAAQRLGARDYLVKPFSFERFRDAIEA
CRRARESLARLPDQLGQGDIDRLFSQPAAADARRPGDLPKGLTPASLAQVAQAILALEDE
SFTSETLLSATGMSRVSVRKYLKHLNDMQLLEESFHYGQIGRPSFRYRCLDRAALQRLAQ
G