Protein Info for PGA1_78p00160 in Phaeobacter inhibens DSM 17395

Annotation: putative sugar-binding periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01547: SBP_bac_1" amino acids 69 to 266 (198 residues), 70.5 bits, see alignment E=2.6e-23 PF13416: SBP_bac_8" amino acids 88 to 347 (260 residues), 55 bits, see alignment E=1.2e-18

Best Hits

KEGG orthology group: K02027, multiple sugar transport system substrate-binding protein (inferred from 66% identity to smd:Smed_1728)

Predicted SEED Role

"ABC-type sugar transport system, periplasmic component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F2P1 at UniProt or InterPro

Protein Sequence (409 amino acids)

>PGA1_78p00160 putative sugar-binding periplasmic protein (Phaeobacter inhibens DSM 17395)
MKLTSILMTTALSVSATIAQSADLEVTHWWTSGGEAAAVTKFADAVNGQTTHNWVDGAIA
GSGTTARPIIISRILGGDPMAATQLTHGRQAEELIEAGLMTDLTELAEQEGWRDIVNPPS
LLDSCTYEGRIYCVPVNIHSTQWLWLSHEAFDKAGMSVPQDWYEFVAAAPKLAEAGIVPL
AMGQQGWQQRIAFGALTVGLVDQDSWRKVSLERDAGVAAGPQYAKVFDAVVDARELARNS
NVQDWNLATNMVITGKAGGQIMGDWAQGEFTLAEQVAGQDYSCLPGMGLNQIIDTSGDAF
YFPVIDDAEVRQAQMDMASVLISKEVQVDFNLTKGSLPVRGDVDLSAANDCMKKGLAILA
DGNVLPSMDQAFSADTQAQIQDLMAEFWASDMAAADAQARYAEIIADAD