Protein Info for Psest_0386 in Pseudomonas stutzeri RCH2

Annotation: Membrane protease subunits, stomatin/prohibitin homologs

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 252 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF01145: Band_7" amino acids 24 to 193 (170 residues), 135.4 bits, see alignment E=1.1e-43

Best Hits

Swiss-Prot: 57% identical to Y1420_ARCFU: Uncharacterized protein AF_1420 (AF_1420) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: None (inferred from 96% identity to psa:PST_3891)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGW9 at UniProt or InterPro

Protein Sequence (252 amino acids)

>Psest_0386 Membrane protease subunits, stomatin/prohibitin homologs (Pseudomonas stutzeri RCH2)
MAYEMSFLVLLVLLVGVLASAFRILREYERGVVFMLGRFWKVKGPGLILIIPGVQQMVRV
DLRTLVLDVPTQDVISRDNVSVKVNAVVYYRVLDAQKAIIEVEDYHSATSQLAQTTLRAV
LGKHELDDMLAERERLNTDIQQVLDAQTDAWGIKVANVEIKHVDLDESMVRAIARQAEAE
RERRAKVIHAEGELQASEKLMQAAEMLGRQSGAMQLRYMQTLSNIAGDKSSTIVFPLPIE
LLQGIKNLDRKP