Protein Info for PGA1_78p00110 in Phaeobacter inhibens DSM 17395

Annotation: putative transporter, MFS family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 45 to 68 (24 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 155 to 173 (19 residues), see Phobius details amino acids 178 to 199 (22 residues), see Phobius details amino acids 219 to 244 (26 residues), see Phobius details amino acids 256 to 274 (19 residues), see Phobius details amino acids 286 to 303 (18 residues), see Phobius details amino acids 309 to 329 (21 residues), see Phobius details amino acids 350 to 370 (21 residues), see Phobius details amino acids 382 to 400 (19 residues), see Phobius details PF05977: MFS_3" amino acids 7 to 372 (366 residues), 111.7 bits, see alignment E=3.4e-36 PF07690: MFS_1" amino acids 15 to 357 (343 residues), 79 bits, see alignment E=3.3e-26 amino acids 227 to 400 (174 residues), 38.5 bits, see alignment E=6.7e-14

Best Hits

KEGG orthology group: None (inferred from 74% identity to sil:SPO1430)

Predicted SEED Role

"FIG00919308: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F2N6 at UniProt or InterPro

Protein Sequence (405 amino acids)

>PGA1_78p00110 putative transporter, MFS family (Phaeobacter inhibens DSM 17395)
MAAPLLLRNRNYRLLFTAGALTNLGDGFILLALPWLATLMTRDPVAIAAVAAAGRLPWLF
FALPAGVIADMTDRRKLIARADLLRAVIVLAILMLALSEPVPGAIWALAGLAFVLGAAEV
IRDNAAQTILPDIVAATDLEAANGQMWTAEQLTGQFIGPPLAGLLIAAGIAIPFGLDVVA
LVLAAGFVWLISLSPRAPVQQGFRKALMQGIRFMRSDTLLLRLAIVLGIANFLATATITV
QVLFAQEVLGLSATEYGFVLSVAALGAVTGSLIAPRLSRLIGVQPCLYLSIAGWAVGYAL
IGISSSGVVMALAMFGVMTAAMVWNVITVSWRQRRIPSELLGRVNSIYRCFGWGSMPLGA
LAGGTVVALMETDLGRDLALRMPFLIAAGCCFLLLIYATLRLRLD