Protein Info for PGA1_78p00100 in Phaeobacter inhibens DSM 17395

Annotation: flavohemoprotein Hmp

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 PF00042: Globin" amino acids 30 to 129 (100 residues), 48.3 bits, see alignment E=2.1e-16 PF00970: FAD_binding_6" amino acids 169 to 256 (88 residues), 22.2 bits, see alignment E=2.3e-08 PF00175: NAD_binding_1" amino acids 268 to 368 (101 residues), 31.1 bits, see alignment E=4.7e-11

Best Hits

Swiss-Prot: 48% identical to HMP_XYLFT: Flavohemoprotein (hmp) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K05916, nitric oxide dioxygenase [EC: 1.14.12.17] (inferred from 59% identity to pde:Pden_1689)

Predicted SEED Role

"Flavohemoprotein (Hemoglobin-like protein) (Flavohemoglobin) (Nitric oxide dioxygenase) (EC 1.14.12.17)" in subsystem Bacterial hemoglobins or Flavohaemoglobin or Glutaredoxins (EC 1.14.12.17)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DWX5 at UniProt or InterPro

Protein Sequence (396 amino acids)

>PGA1_78p00100 flavohemoprotein Hmp (Phaeobacter inhibens DSM 17395)
MAQPLSEQSKAIVTATVPALEAHGGAIVAEMYTRLLADEDIKALFNQSHQQGDSSQHAAL
ANAILGYARNIDNLGALSSVVERIVNKHVSLQIKPEHYTHVATALLGAIEAVLGQAASPE
VLEAWGEAYWFLANLLIEAERKMYDDIANAEGGWNGWREFVIVGIIGESASVKSFVLRPV
DGGPVLRHQPGQYLAFDFDHPDTGKARRNYSISCAPNGEYYRISVKREPGGVISGWLHEV
ATEGTVLRVAAPAGDFVLKDRPEGEVVLLSAGVGLTPMVAMLETLAANDRSATYLHAAVD
GDNLAMEGLSKSLAKRSVIFLETPSDADRAAARYDVEGRITPDWLAANTNTALSDYYICG
PKGFMAMAIAGLRAANVDMDRIHFEFFGPAEDLGVA