Protein Info for HP15_372 in Marinobacter adhaerens HP15

Annotation: ribosomal protein L7/L12

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 125 TIGR00855: ribosomal protein bL12" amino acids 1 to 125 (125 residues), 163.5 bits, see alignment E=1.4e-52 PF16320: Ribosomal_L12_N" amino acids 5 to 50 (46 residues), 57.9 bits, see alignment E=6.6e-20 PF00542: Ribosomal_L12" amino acids 59 to 125 (67 residues), 108 bits, see alignment E=2.5e-35

Best Hits

Swiss-Prot: 87% identical to RL7_MARHV: 50S ribosomal protein L7/L12 (rplL) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K02935, large subunit ribosomal protein L7/L12 (inferred from 87% identity to maq:Maqu_0711)

MetaCyc: 62% identical to 50S ribosomal subunit protein L12 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L7/L12 (P1/P2)" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PLY0 at UniProt or InterPro

Protein Sequence (125 amino acids)

>HP15_372 ribosomal protein L7/L12 (Marinobacter adhaerens HP15)
MALSNEDILNAIAEMSVMDVVALVEAMEEKFGVSAAAAVAAAPAAAGGGEAAAEEQTEFD
VVLTGPGEKKVNVIKAVRELTGLGLKEAKEMVDSAPSVIKEAASKDDAEEAKKKLEEAGA
SVELK