Protein Info for PGA1_262p02380 in Phaeobacter inhibens DSM 17395

Annotation: putative histidine transport system permease protein HisM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 28 to 30 (3 residues), see Phobius details amino acids 50 to 70 (21 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 125 to 142 (18 residues), see Phobius details amino acids 199 to 214 (16 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 40 to 149 (110 residues), 55.2 bits, see alignment E=4.2e-19 PF00528: BPD_transp_1" amino acids 64 to 254 (191 residues), 61.2 bits, see alignment E=5.7e-21

Best Hits

Swiss-Prot: 39% identical to OCCM_RHIRD: Octopine transport system permease protein OccM (occM) from Rhizobium radiobacter

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 76% identity to sil:SPOA0071)

Predicted SEED Role

"ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E6N3 at UniProt or InterPro

Protein Sequence (258 amino acids)

>PGA1_262p02380 putative histidine transport system permease protein HisM (Phaeobacter inhibens DSM 17395)
MTSFKSLTQPHRLVLIALFAALVVWCAVSLRWDWIPTYAPLALEGLWTTIWILVVTSILG
FALAVPLGLAQAVGPWYLSTPARIFCTVIRGTPLLLQIWLLYYGLGSLFPQFPWIRSSEL
WPYLRQAWPYAVLALTLSYAGYEGEVMRGAFSGVAKGQLEAAKAYGMPRLTMFRRIWLPQ
AVRNVLPTLGGETILQLKATPLVATITVLDIYAVSSRVRSDTFIVYEPLLLLALVYMAIA
GVITLAFKRFEDRVPQRR