Protein Info for PGA1_262p02370 in Phaeobacter inhibens DSM 17395

Annotation: putative histidine transport system permease protein HisQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 signal peptide" amino acids 1 to 15 (15 residues), see Phobius details transmembrane" amino acids 35 to 56 (22 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 109 to 127 (19 residues), see Phobius details amino acids 160 to 180 (21 residues), see Phobius details amino acids 209 to 234 (26 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 27 to 133 (107 residues), 52.1 bits, see alignment E=3.8e-18 PF00528: BPD_transp_1" amino acids 46 to 239 (194 residues), 83.2 bits, see alignment E=1e-27

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 82% identity to sil:SPOA0070)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ET22 at UniProt or InterPro

Protein Sequence (250 amino acids)

>PGA1_262p02370 putative histidine transport system permease protein HisQ (Phaeobacter inhibens DSM 17395)
MTGLLDLFGLAESAQLLSLSPPGWGGNLLRGLANSLQIALGAFGMGLIIGLFGAYGKLYG
GPILRDLLAIYTTVIRAVPELVLILILYYVGTDLINKVAGSLGYGRVEISGIVAGIWVLG
IVQGAYATEVLRGAIKAVPPGQIEAARSYGMPPFMTMRRVTIPAMMSFATPGLANLWLIA
TKDTALLAIVGFAELTLETRQAASSTRAYFTFFLAAGALYLMITLCSSVIFGWIERWARR
GQPSLRERRQ