Protein Info for Psest_3900 in Pseudomonas stutzeri RCH2

Annotation: Spermidine/putrescine-binding periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF01547: SBP_bac_1" amino acids 43 to 160 (118 residues), 31.5 bits, see alignment E=2.9e-11 PF13416: SBP_bac_8" amino acids 49 to 319 (271 residues), 77 bits, see alignment E=3.3e-25 PF13343: SBP_bac_6" amino acids 94 to 319 (226 residues), 62.7 bits, see alignment E=5.6e-21

Best Hits

KEGG orthology group: None (inferred from 80% identity to psa:PST_0371)

Predicted SEED Role

"Predicted polyamine sensor NspS, involved in biofilm formation" in subsystem Polyamine Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSL3 at UniProt or InterPro

Protein Sequence (361 amino acids)

>Psest_3900 Spermidine/putrescine-binding periplasmic protein (Pseudomonas stutzeri RCH2)
MPHNNKKPALWRARTLLVMLLGLLSPSTSLHAGETLTLLTWEEYLSEAVIKRWQAETGVE
IRQVYFDSGDKRDEILAKPDHQIDIALTELISSTRFGARGLLQPLDEPSLAELHRAAPRW
RDSCGRYSVPYLWGTLGIAYRSDRLDFVPHSWADLLRPARPDEPHIIMMEDHEDILASPL
LLLKHSINTSDNDELKAAFELLVSQSEAVLTYEYVITALRSQRHLERADMALAYSGDQQV
LNQVEGVEGEPWRYVVPEEGTLLWVDCLSVPSIARNKPLAYRFLNFLNRPDIAVLNAAEL
GVATPNAAAQALLPEEIRNDLTIYPAEKVLARSQVYEMRPLEATQTRRRIISALINAHDA
R