Protein Info for HP15_3767 in Marinobacter adhaerens HP15

Annotation: sensory box/GGDEF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 784 transmembrane" amino acids 13 to 37 (25 residues), see Phobius details amino acids 272 to 291 (20 residues), see Phobius details PF14827: dCache_3" amino acids 42 to 229 (188 residues), 26.3 bits, see alignment E=1.1e-09 PF00672: HAMP" amino acids 289 to 341 (53 residues), 25 bits, see alignment 3.9e-09 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 349 to 487 (139 residues), 55.8 bits, see alignment E=2.2e-19 PF00990: GGDEF" amino acids 350 to 496 (147 residues), 79.5 bits, see alignment E=5.1e-26 PF00563: EAL" amino acids 522 to 755 (234 residues), 234.6 bits, see alignment E=2.1e-73

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PI45 at UniProt or InterPro

Protein Sequence (784 amino acids)

>HP15_3767 sensory box/GGDEF family protein (Marinobacter adhaerens HP15)
MSLVSRLGFRGRLIVAMISLVALVSLVIVALLMVYLFEDEKSRALEQLAIGERLTNEVID
RRTELELSRLSVVVQDFGFRSAIASRDPATIDSALENHSGRVGADFALLLDSQGEPLAST
LQNPFPAVSQEQLTSTRRNGFTRSLRAIDGRGYEILIIPIEAPGLRASLVSGFAMDQSLA
EVIARLSGTSVIFRARSNQNDNLNSFAATSSIDAKLEQELAGASANANFIESAGYFTRII
NLGESDPAAVQAVLLISRDATLQNYYRRAVEIALLVTAILIFAILLALVIARNLGRPVLQ
LASYARAIGEGTTPEAPAIRAGGELTQLRNALRDMLSGLREREAQIRYAATHDDVTGLKN
RNALMQEAAELFENRGTGSLVGIRLNDLSDINDTLGLEFGDKVLIGIAKRLQQELPDAHI
LARTGGGEFLALIPSLPPEQGSDRIRQLHALIESPLQVDQTPFSLRVTIVTMELPEDASD
TDALRRRLNLTFEQAEAHPEAFTRYKPGQDESHLRELKLVTDLHTAILNNGLHMNYQPKL
NSQTGELVQVEALVRWIHPELGFISPEEFIFLAEQSGQIHDLTAHILQRVASDARRWHEQ
GVDAGVAINLSAMDLTWPALIQHIGDTFEGWHHNLERVTLEVTESALMEDPEEAMATLNR
LRELGVTLSVDDFGTGYSSLSQLRKLPVQELKIDKSFVLRLDTEPQDQLIVRSTIDMAHG
LGLKVVAEGIENLEAWRLLQHWGCNLAQGFYLSRPVAPEDLPETARALADRREELTHTNP
EYSE