Protein Info for PGA1_262p02260 in Phaeobacter inhibens DSM 17395

Annotation: putative two-component sensor histidine kinase/response regulator hybrid protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 759 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 147 to 170 (24 residues), see Phobius details PF00512: HisKA" amino acids 239 to 304 (66 residues), 77.3 bits, see alignment E=1.5e-25 PF02518: HATPase_c" amino acids 351 to 465 (115 residues), 97.3 bits, see alignment E=1.5e-31 PF00072: Response_reg" amino acids 486 to 599 (114 residues), 53.5 bits, see alignment E=5.3e-18 amino acids 632 to 745 (114 residues), 86.2 bits, see alignment E=3.6e-28

Best Hits

KEGG orthology group: None (inferred from 59% identity to sit:TM1040_3612)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F2L7 at UniProt or InterPro

Protein Sequence (759 amino acids)

>PGA1_262p02260 putative two-component sensor histidine kinase/response regulator hybrid protein (Phaeobacter inhibens DSM 17395)
MKRTGILFQIVVSLSLAALLVAAAIGDVARRYETRNLQAQLKEQAELTISLLSGLMLESI
IVEDVPVLETGLIEAIARNPKLLQIQIQNSAGTPIAEAGEIDQVGPDDFVMYDRPITLDG
FDFGRMVVHWSTREGQAMVQHKVSQTIMWTVVAVAILSLLVLILVSVLALRPLQIIHQRM
SGAIAGLSGLQARLPWFASREFRALNFSVGVLEDTFSERDEREYALEEARKAADIANRAK
SEFLANMSHEIRTPMNGVIGMAELILETDLDEDQTMYAETISKSGSALLTIINDILNFSK
IEAGKMELERAPFNLQTAIEDVVTLLSPKAAEKNVEVTLRYDPSLPECYEGDVGRIRQIL
TNVAGNAVKFTGKGYVYIEVSGETDDDRTALRISVTDTGAGIPEDRLDRIFNAFEQADGA
ATRNYEGTGLGLAISTRLLELMGGRISVQSELGKGSVFAIDLPLRIRPSQPKRAQDARDF
KGLRALVVDDLELNRIILTERLATWGVQSVAAGSAHQALELLLDSRHDGTHYDVILQDFQ
MPGMDGKELAERIRDIPEYRDLPIVILSSVENTIDREAREHLGRCEVALKPLRAAQLQSV
MSRVLETATEEAPQAVPPQGVETSVVPEVKLLLAEDNRTNQLVVSRMLKAAPIEVLIAAN
GEEAVTMFQEHHPDIVLMDMMMPVKDGIDATAEIRQLEKDNGLGRCPVVALTANALQSHR
EECLAAGMDDFLSKPINKKALLGAVGKWVDCGPLLKTGT