Protein Info for Psest_3884 in Pseudomonas stutzeri RCH2

Annotation: Signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 signal peptide" amino acids 1 to 51 (51 residues), see Phobius details transmembrane" amino acids 183 to 204 (22 residues), see Phobius details PF26769: HAMP_PhoQ" amino acids 207 to 251 (45 residues), 46.7 bits, see alignment 3.8e-16 PF00512: HisKA" amino acids 260 to 311 (52 residues), 32.5 bits, see alignment 1.1e-11 PF02518: HATPase_c" amino acids 363 to 463 (101 residues), 58.8 bits, see alignment E=1.1e-19

Best Hits

KEGG orthology group: K07637, two-component system, OmpR family, sensor histidine kinase PhoQ [EC: 2.7.13.3] (inferred from 93% identity to psa:PST_0388)

Predicted SEED Role

"Sensor protein PhoQ (EC 2.7.13.3)" in subsystem Lipid A modifications (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GSS1 at UniProt or InterPro

Protein Sequence (465 amino acids)

>Psest_3884 Signal transduction histidine kinase (Pseudomonas stutzeri RCH2)
MSRRWRRLQARARNRLTGAMSLRLRLMFGAASLAVLFMLALLPALQGAFSLSFEKVIEQR
LAADASTLITAAQVEGGRLQMPERLPDEEFDLPDAQLLGFIYDRRGELVWHSRSAADERI
DYRPRYEGGSTEFLRVRDADGMEYFVYDVELQLAGSRDNAFSFVTMQPTSEYLSLFDEFR
RQLYLWLGSGLLVLLALLWLGLTWGFRTLKRVSAELDQVEASQRERLSDDHPRELLRLTR
SLNRLLDSERRQREQYRNSLGDLAHSLKTPLSVLQGVGETLAAQAQSREQAQVMQAQIER
MSQQIGYQLQRASLGKSGLVRHRVQLRPLLDSLCSTLDKVYRDKHVQVDMQLAESCLVPM
EQGALMELLGNLLENAYRLCLGQIRISALPDGDNLLLLVEDDGPGVPVDQRARIIRRGER
LDGQHPGQGIGLAVVKDILDSYGGELSLGESQLGGAAFQIRLRAD